PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0008s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 517aa    MW: 56317.7 Da    PI: 5.6689
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0008s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-174087148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  SapurV1A.0008s0050.1.p 40 KGPWTSVEDAILIDYVKKHGEGNWNSVQKHSGLFRCGKSCRLRWANHL 87
                            79******************************************9986 PP

2Myb_DNA-binding50.16.4e-1693136146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +g++T+eE+ +++++++ +G++ W++ a++++ gRt++++k++w++
  SapurV1A.0008s0050.1.p  93 KGSFTPEEENRIIQLHANMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                             799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4763587IPR017930Myb domain
SuperFamilySSF466892.88E-2937134IPR009057Homeodomain-like
SMARTSM007173.6E-153989IPR001005SANT/Myb domain
PfamPF002493.0E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-234194IPR009057Homeodomain-like
CDDcd001676.57E-124287No hitNo description
PROSITE profilePS5129424.18888142IPR017930Myb domain
SMARTSM007177.7E-1592140IPR001005SANT/Myb domain
PfamPF002495.3E-1593136IPR001005SANT/Myb domain
CDDcd001674.41E-1195136No hitNo description
Gene3DG3DSA:1.10.10.606.6E-2695140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MSSMMNGTED NMWSKDRRDS PAADEGIDGG MVGGISPLKK GPWTSVEDAI LIDYVKKHGE  60
GNWNSVQKHS GLFRCGKSCR LRWANHLRPD LKKGSFTPEE ENRIIQLHAN MGNKWARMAA  120
ELPGRTDNEI KNYWNTRTKR LQRAGLPLYP PEVCLQGYKM NKDGQNMGKL QTGDAHDPDM  180
MLTEHFKIPE VEFKTLALNP GVLPYSTDLF DASASSVLKQ GVGLSYGQGL VIPTIHPAKR  240
FRESQTIFTG LDGSVSTGIS EFDQLTDYHH GKITGNFGLS SPYSCDLNNY EQSSCGVLPG  300
SHAILNGNSS SSCEPICGAM KLELPSLQCS ETQQDSWGTP ASPLPSLESA DALIQSPPTK  360
ETNSDGQSPR SSGLLEAVLY ESRALKHSKK SPGHQTSDAF VANGWGAHSS PMNVCAAEWE  420
LHADLNSPSG HSASSLFSEC TPISGSSSDE QAYTVRPEPI DQVLSYVEAR EVLHQTDCNR  480
PDVLLGSTWF APSNKYHNDH FFQTDDVAAL LGGDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30341401106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298147.20.0hypothetical protein POPTR_0001s23170g
TrEMBLB9GEM70.0B9GEM7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.14e-96myb domain protein 65